Protein Info for GFF3394 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF02798: GST_N" amino acids 1 to 72 (72 residues), 59.8 bits, see alignment E=8.1e-20 PF13417: GST_N_3" amino acids 3 to 80 (78 residues), 51.5 bits, see alignment E=3.2e-17 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 63.3 bits, see alignment E=8.1e-21 PF13410: GST_C_2" amino acids 129 to 193 (65 residues), 36.6 bits, see alignment E=1.2e-12 PF00043: GST_C" amino acids 132 to 199 (68 residues), 43.6 bits, see alignment E=8.6e-15 PF14497: GST_C_3" amino acids 139 to 202 (64 residues), 27.7 bits, see alignment E=7.8e-10

Best Hits

Swiss-Prot: 42% identical to GST2_YEAST: Glutathione S-transferase 2 (GTT2) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_3324)

MetaCyc: 42% identical to glutathione transferase 2 monomer (Saccharomyces cerevisiae)
Glutathione transferase. [EC: 2.5.1.18]; 2.5.1.18 [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF3394 hypothetical protein (Xanthobacter sp. DMC5)
MKLYDTNRAPNPRRVRIFLAEKGISVPLEPVDLGKGEHKSAEFTGLNPRQRVPLLVLDNG
TAIAETMAICRYFEALQPEPNLFGHTPEEQGLVEMWQRQVELDLFYPIMMVLRHLNPAMA
QMEVPQVPEWGEANKPKVLAALGFFNDQLADRAFVAGSRFSVADITMLVAVDFLRVIRTE
VPEHHTHLNRWYDVVSQRPSTKA