Protein Info for PS417_17365 in Pseudomonas simiae WCS417

Updated annotation (from data): galactaro-1,5-lactonase
Rationale: Specifically important in carbon source D-Galacturonic Acid monohydrate. This is the second step after D-galacturonate dehydrogenase (PS417_17360) and forms meso-galactarate, which is the substrate of PS417_04210. The substrate is probably the 1,5-lactone, not the 1,4-lactone, given the characterization of the D-galacturonate dehydrogenase from Agrobacterium tumefaciens (PMID:24450804), which is 51% identical to PS417_17360.
Original annotation: gluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF08450: SGL" amino acids 13 to 261 (249 residues), 275.2 bits, see alignment E=2.8e-86

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3950)

Predicted SEED Role

"Gluconolactonase (EC 3.1.1.17)" in subsystem Entner-Doudoroff Pathway (EC 3.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.17

Use Curated BLAST to search for 3.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYW3 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PS417_17365 galactaro-1,5-lactonase (Pseudomonas simiae WCS417)
MNAELIVDARNAVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIAR
TDAGNWVAGMETGFFQLTPHNDGSLDTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVL
NMGLNAAEGTLYRYTSGAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFDYD
IDTGTPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTVPV
KKPTMCAFGGSRLDTLFVTSIRDDQSEQSLSGGVFALNPGVVGLPEPTFTL