Protein Info for GFF3386 in Xanthobacter sp. DMC5

Annotation: Zinc transport protein ZntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 272 to 293 (22 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details PF01544: CorA" amino acids 41 to 327 (287 residues), 251 bits, see alignment E=7.9e-79

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 81% identity to xau:Xaut_3316)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF3386 Zinc transport protein ZntB (Xanthobacter sp. DMC5)
MAALASTIDTQGLLSAWMFDGKGGASRLRPEDAVSATAPDGGFVWLHFRHLPRMPQTWLR
QGVGLDAPALESMAEEHCRPRCVMFAEGALLSLRGINLQRNALPEELITVHLWVDARRIV
SVQHDFLSAIADFDDALGRGRCPRSQGEFVADLSMRLVERVDAVVTTLIEEADELEDAVL
ITETSELLPKLAVLRRVAIKLRRHIAPQREALNHFALEDDPWMGPKDRNRLRDAADRVAR
FSEELDSVRERASVIRDQMVDARAEQMNKSMLVLAVVTVVFAPMTLISGMFGMNVGGIPG
SSDPAAFWALSVFLLLLGFVLLWTFRRLKWI