Protein Info for PS417_17330 in Pseudomonas simiae WCS417

Updated annotation (from data): Dihydropyrimidine dehydrogenase (NADP(+)) (EC 1.3.1.2)
Rationale: Specifically important for utilizing Cytidine. Automated validation from mutant phenotype: the predicted function (1.3.1.2) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: dihydropyrimidine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 5 to 320 (316 residues), 168.5 bits, see alignment E=9.2e-54 PF01180: DHO_dh" amino acids 6 to 305 (300 residues), 103.4 bits, see alignment E=4.2e-33 PF01207: Dus" amino acids 122 to 182 (61 residues), 27.5 bits, see alignment E=5.1e-10 PF12837: Fer4_6" amino acids 337 to 363 (27 residues), 25.9 bits, see alignment (E = 2.2e-09) PF14697: Fer4_21" amino acids 338 to 400 (63 residues), 72.1 bits, see alignment E=1e-23 PF12838: Fer4_7" amino acids 345 to 394 (50 residues), 36 bits, see alignment 2.3e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU3944)

MetaCyc: 60% identical to (NADP)-dependent dihydropyrimidine dehydrogenase (Brevibacillus agri)
Dihydropyrimidine dehydrogenase (NADP(+)). [EC: 1.3.1.2]; 1.3.1.2 [EC: 1.3.1.2]

Predicted SEED Role

"Dihydropyrimidine dehydrogenase [NADP+] (EC 1.3.1.2)" in subsystem Pyrimidine utilization (EC 1.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJW7 at UniProt or InterPro

Protein Sequence (424 amino acids)

>PS417_17330 Dihydropyrimidine dehydrogenase (NADP(+)) (EC 1.3.1.2) (Pseudomonas simiae WCS417)
MADLSIVFAGIKAPNPFWLASAPPTDKAYNVVRAFEAGWGGVVWKTLGEDPAAVNVSSRY
SAHYGPNREVMGINNIELITDRSLEINLREITQVKKDWPDRALIVSLMVPCVEESWKTIL
PLVEATGCDGIELNFGCPHGMPERGMGAAVGQVPEYVEQVTRWCKTYCSLPVIVKLTPNI
TDIRVAARAAYRGGADAVSLINTINSITSVDLERMVALPVVGTQSTHGGYCGSAVKPIAL
NMVAEIARDPQTQGLPICGIGGIGNWRDAAEFVALGCGAVQVCTAAMLHGFRIVEEMKDG
LSRWMDSQGYNSLQDFSGRAVGNTTDWKYLDINYQVIAKIDQEACIGCGRCHIACEDTSH
QAIASLKQADGTHKYEVIDDECVGCNLCQITCPVADCIEMVPMDTGKPFLNWTQDPRNPY
REAV