Protein Info for GFF3386 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: YcfF/hinT protein: a purine nucleoside phosphoramidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 11 to 112 (102 residues), 85.8 bits, E=3.1e-28
• PF01230: HIT
  • amino acids 18 to 115 (98 residues), 108.8 bits, E=1.9e-35

Best Hits

Swiss-Prot: 98% identical to HINT_ECOLI: Purine nucleoside phosphoramidase (hinT) from Escherichia coli (strain K12)

KEGG orthology group: K12150, HIT-like protein HinT (inferred from 98% identity to ecc:c1376)

MetaCyc: 98% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"YcfF/hinT protein: a purine nucleoside phosphoramidase"

Protein Sequence (125 amino acids)

>GFF3386 YcfF/hinT protein: a purine nucleoside phosphoramidase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKENVVAEETIFSKIIRREIPSDIVYQDELVTAFRDISPQAPTHILIIPNILIPTVNDV
TAEHEQALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPLGPML
AHKGL