Protein Info for GFF3385 in Variovorax sp. SCN45

Annotation: Flavin-containing monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 PF12680: SnoaL_2" amino acids 21 to 115 (95 residues), 30.6 bits, see alignment E=1.3e-10 PF07992: Pyr_redox_2" amino acids 170 to 396 (227 residues), 46.8 bits, see alignment E=8.6e-16 PF13738: Pyr_redox_3" amino acids 172 to 375 (204 residues), 62.9 bits, see alignment E=9.3e-21 PF00743: FMO-like" amino acids 211 to 369 (159 residues), 52.7 bits, see alignment E=7.7e-18 PF13434: Lys_Orn_oxgnase" amino acids 267 to 367 (101 residues), 23.5 bits, see alignment E=8.6e-09

Best Hits

KEGG orthology group: K07222, putative flavoprotein involved in K+ transport (inferred from 94% identity to vap:Vapar_0076)

Predicted SEED Role

"Flavin-containing monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (603 amino acids)

>GFF3385 Flavin-containing monooxygenase (Variovorax sp. SCN45)
MTDPTLSPSGPTQAASQWLADFAAALARSDIDAAVALFEPDSFWRDLVAFTWNIRTQEGP
AAIRAMLQARLADTQPTAFTVEGEATEADGVVDAWFTFETRVARGRGHLRLRNGKAWTLL
TTMTELKGFEEKTGDNRVKGAEHGVHKGRKNWLEKRRDEEAALGYTEQPEVVIIGGGQGG
IALGARLRRLGVPAIIVERNAKAGDSWRKRYKSLCLHDPVWYDHLPYMPFPDDWPVFAPK
DKIGDWLEMYTKIMELNYWSSTTARKARFDEATQRWEVTVEREGKPVVLRPRQLVFALGV
SGYPNVPKVAGAENFKGDQHHSSQHPGSEAYAGKKCVVLGSNNSAHDICAALWEHGADVT
MIQRSSTHIAPSQSLMELALGELYSEQAVRNGIDHHKGDLIFASVPYKIMHTFHIPVYEE
MKKRDADLYARLEKAGFLLDFGVDGSGLFMKYLRRGSGYYIDVGASELVANGSIHLKSGV
NIERVNERSVTLTDGTELPADLLVYATGYGSMNGWLADLISPEIADKVGKCWGLGSDTPK
DPGPWEGELRNMWKPTQVDNLWFHGGNLHQSRHYSQFLALQLKARMEGIDTPVYERAPSH
HTR