Protein Info for GFF3372 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphate:acyl-ACP acyltransferase PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF02504: FA_synthesis" amino acids 1 to 321 (321 residues), 422.5 bits, see alignment E=5.5e-131 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 1 to 335 (335 residues), 474.5 bits, see alignment E=9.1e-147

Best Hits

Swiss-Prot: 100% identical to PLSX_SALSV: Phosphate acyltransferase (plsX) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to seh:SeHA_C1306)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF3372 Phosphate:acyl-ACP acyltransferase PlsX (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGGDFGPSVTVPAALQALNANSQLTLLLVGNPDIITPLLAKADFEQRSRLQIIPAQSVIA
SDARPSQAIRASRGTSMRVALELVKEGRAEACVSAGNTGALMGLAKLLLKPLEGIERPAL
VTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAVMGAVLAEEVVGIKNPRVALLNIGEEET
KGLDSIREASLMLKTVPTINYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFL
SLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHLNPDQYNGACLLGLRGTVIKSHGAANQ
RAFAVAIEQAVQAVQRQVPQRIAARLESVYPAGFEPLDDGKGVNLRAHR