Protein Info for GFF3371 in Variovorax sp. SCN45

Annotation: FIG00456413: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 444 to 461 (18 residues), see Phobius details PF01970: TctA" amino acids 18 to 434 (417 residues), 78.8 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to vpe:Varpa_0081)

Predicted SEED Role

"FIG00456413: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF3371 FIG00456413: hypothetical protein (Variovorax sp. SCN45)
VIDAALLNQILVATGMGLVGAVVFAAIGLVSGTDETTTLAPLTLLVVLLGVPPEGVFTFF
LAAAVAKHMTHAVPTALLGIPGDTMATPLLQDANVLRNLGVPHIALRKMVSGAIIAAFIA
VPLAVLFAVLLAPYGAAITKAAPWIFVVAAVAIAYFSSGRWASVATLVPFVMVIVALQAL
TGKYGVKLSISYFLGIAIGPLVADLFSVISPAARARMKREKVRTFSLAPDVKGWSGYFPN
PFRVLDRGQVKWTLATATISSATFVFSPVAMTVVLGELVGSRIRHAYHRLTTTLAARNGV
TEATYIAEALIPLIAIGLPLSPVAAGPAAPLFNAPPVFTIDSATGQTHNLHNLLSHWEFL
GYGMLAVVLAALVAYPFTMNFARRAALFVSRKVSHEAIIATFVGLIVVISVWEGQLLGLL
VILTMGLLGGLLSRAIGFNTGVQFMGYYTAVLTVPAVIKAFG