Protein Info for GFF3370 in Xanthobacter sp. DMC5

Annotation: Low-molecular weight cobalt-containing nitrile hydratase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02979: NHase_alpha
  • amino acids 23 to 202 (180 residues), 259.8 bits, E=5.4e-82
• TIGR01323: nitrile hydratase, alpha subunit
  • amino acids 24 to 205 (182 residues), 251.6 bits, E=4e-79

Best Hits

Swiss-Prot: 45% identical to NHA1_RHORH: High-molecular weight cobalt-containing nitrile hydratase subunit alpha (nhhA) from Rhodococcus rhodochrous

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 66% identity to mpo:Mpop_3787)

MetaCyc: 51% identical to ToyJ (Streptomyces rimosus)
4.2.1.-

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

• superpathway of acrylonitrile degradation (3/3 steps found)
• acrylonitrile degradation I (2/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (2/2 steps found)
• sangivamycin biosynthesis (1/1 steps found)
• aldoxime degradation (2/3 steps found)
• indole-3-acetate biosynthesis II (6/12 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Protein Sequence (207 amino acids)

>GFF3370 Low-molecular weight cobalt-containing nitrile hydratase subunit alpha (Xanthobacter sp. DMC5)
MTSTPAEMSAIPVIEGYDGADYYALMTRALHQILLEEGLLAPEETDKVIAALEAPRPEWG
ARLVARAWVDTAFKERLLADGASAAAELGFTIKEAQLVVVENTDDLHNLIVCTLCSCYPR
SLLGQPPWWYISKSYRARAVREPRAVLEEFGMALPESVHVRVHDSNADMRYLVLPQRPAG
TEDAREEDLARLVTRDSMIGTAQVSAS