Protein Info for GFF3369 in Variovorax sp. SCN45
Annotation: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to Y1161_HAEIN: Putative esterase HI_1161 (HI_1161) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: None (inferred from 99% identity to vpe:Varpa_0077)MetaCyc: 47% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]
Predicted SEED Role
"uncharacterized domain 1"
MetaCyc Pathways
- superpathway of chorismate metabolism (42/59 steps found)
- 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
- superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
- superpathway of menaquinol-10 biosynthesis (4/10 steps found)
- superpathway of menaquinol-11 biosynthesis (4/10 steps found)
- superpathway of menaquinol-12 biosynthesis (4/10 steps found)
- superpathway of menaquinol-13 biosynthesis (4/10 steps found)
- superpathway of menaquinol-6 biosynthesis (4/10 steps found)
- superpathway of menaquinol-7 biosynthesis (4/10 steps found)
- superpathway of menaquinol-9 biosynthesis (4/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (3/9 steps found)
- superpathway of phylloquinol biosynthesis (4/15 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.2.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (140 amino acids)
>GFF3369 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis (Variovorax sp. SCN45) MRIWKKEISVEELTRNHVGTAVSTLGMEFLEVGDDFIRARCPVDERTRQPYGILHGGVSV VLAETLGSCGAHYSAPEGDRAVGLDINANHIRSVTSGWVIGTARPVHRGRTTQVWQIDLT NEAGELTCVSRITMAVLQPR