Protein Info for PS417_17220 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator HU subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 112.6 bits, see alignment E=8.8e-37 PF18291: HU-HIG" amino acids 2 to 88 (87 residues), 26.5 bits, see alignment E=6e-10

Best Hits

Swiss-Prot: 96% identical to DBHB_PSEF5: DNA-binding protein HU-beta (hupB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03530, DNA-binding protein HU-beta (inferred from 100% identity to pfs:PFLU3926)

Predicted SEED Role

"DNA-binding protein HU-beta" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8K5 at UniProt or InterPro

Protein Sequence (90 amino acids)

>PS417_17220 transcriptional regulator HU subunit alpha (Pseudomonas simiae WCS417)
MNKSELIDAIAASADIPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARTG
RNPQTGKALQIAAAKKPGFKAGKALKEAVN