Protein Info for PS417_17210 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 352 (329 residues), 129.9 bits, see alignment E=1.1e-41

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU3923)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBM4 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PS417_17210 MFS transporter (Pseudomonas simiae WCS417)
MTSLTDPAVTDRRDTLPLSGLLALASAGFITILTEAMPAGLLPQIGEGLGVSPALVGQMV
TVYALGSLLAAIPLTLLTRGWRRRPLLLLAIGGFALVNSVTALSSHYGLTLVARFLAGVW
AGLLWALLAGYASRMVAPHLQGRAIAVAMLGAPLALSLGVPAGTFLGAAVGWRLSFAIMT
GLTLVLLAWARWQLPDFAGEPAGKRLGLHQVLTLPGIRPVLWVTFTYVLAHNILYTYIAP
LLVPAGIAADIDQVLLVFGLAALLSIWMAGVLIDRWLRVLLLISCTMFGLIALALAFWIN
LPAVIYVAVALWGLAFGGLPALLQTALAQSAGESADAAQSMLVTVWNLGIAGGGLVGGVL
LQGWGACAFAWAVVLLMLLAVAGGLQTAPQQLARPPFKIER