Protein Info for GFF3356 in Xanthobacter sp. DMC5

Annotation: Flavin reductase (NADH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to RUTF_PSE14: FMN reductase (NADH) RutF (rutF) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: None (inferred from 46% identity to mmt:Metme_3279)

MetaCyc: 42% identical to DmoB (Hyphomicrobium sulfonivorans)
RXN-9740 [EC: 1.14.13.131]

Predicted SEED Role

No annotation

MetaCyc Pathways

dimethyl sulfide degradation I (1/2 steps found)
superpathway of dimethylsulfone degradation (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>GFF3356 Flavin reductase (NADH) (Xanthobacter sp. DMC5)
MSRSAPLATSPVEAADFKAAMRALAASVTVITSRRGDQLNGMTATAVCSVSTAPPQILAV
VNRETTSHGLIADSGAFAVNILAAHQQDLAGRFARRLDEPFEGVAHGWGETGCPLLAEAV
AVIECRLRERHHAGTHTIFVGEVVGVSCRGAEPLLYFDGGYRRLAATGGAVV