Protein Info for PS417_17160 in Pseudomonas simiae WCS417

Annotation: 1-aminocyclopropane-1-carboxylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 20 to 284 (265 residues), 38.7 bits, E=4e-14

Best Hits

KEGG orthology group: K01505, 1-aminocyclopropane-1-carboxylate deaminase [EC: 3.5.99.7] (inferred from 85% identity to pfs:PFLU3914)

Predicted SEED Role

"1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7)" (EC 3.5.99.7)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine degradation II (3/3 steps found)
• L-threonine degradation I (4/6 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.7

Sequence Analysis Tools

See A0A1N7U0W9 at UniProt or InterPro

Protein Sequence (294 amino acids)

>PS417_17160 1-aminocyclopropane-1-carboxylate deaminase (Pseudomonas simiae WCS417)
MGPFDWLPHAPLEPLRLDWLSGVELAVLRLDRIDPLISGNKWFKLTGHLAQAQNARGIIS
LGGAYSNHLHALAAAGKRFGFPTVGLLRGHPQDTPTVLDLKAFGMHLHWLGYGGYRARHE
PAFWLPWREHYPHLHPVPEGGGGLAGASGCGVLVEQARAQLQALGWADYDAWWLAAGTGT
TLAGLVLAEAGAHPVYGALAVPDDHGVAQNIGAIVQAGYELLDASRGGFAKVDPVLLDFI
DTTQQTCGLPLEPLYTGKALLALKAQVEAGRFTPGTRLIFVHTGGLQGRRGFTG