Protein Info for PS417_17150 in Pseudomonas simiae WCS417

Annotation: phosphonoacetaldehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR01422: phosphonoacetaldehyde hydrolase" amino acids 9 to 259 (251 residues), 384.6 bits, see alignment E=1.9e-119 PF00702: Hydrolase" amino acids 10 to 201 (192 residues), 70.4 bits, see alignment E=2.8e-23 PF13419: HAD_2" amino acids 17 to 206 (190 residues), 33.4 bits, see alignment E=5e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 67 to 206 (140 residues), 46.6 bits, see alignment E=4.1e-16

Best Hits

Swiss-Prot: 97% identical to PHNX_PSEFS: Phosphonoacetaldehyde hydrolase (phnX) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 97% identity to pfs:PFLU3912)

MetaCyc: 85% identical to phosphonoacetaldehyde hydrolase subunit (Pseudomonas aeruginosa)
Phosphonoacetaldehyde hydrolase. [EC: 3.11.1.1]

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJT9 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PS417_17150 phosphonoacetaldehyde hydrolase (Pseudomonas simiae WCS417)
MNYQTPNTLQAVILDWAGTVVDFGSFAPTQIFVEAFAEFDVQVSIEEARGPMGMGKWDHI
RTLCDQPQVAERYRKAFGRTPTDDDVTAIYQRFMPLQIEKIAEHSALIPGALDTIARLRV
QGIKIGSCSGYPKQVMDKVVALAATNGYIADHVVATDEVPNGRPWPAQALANVIALGIDD
VAACVKVDDTVPGILEGRRAGMWTVALTCSGNALGLTYEQFRALDGAALASERKRIEAMF
EGSRPHYLIDTINDLPAVILDINARLARGEMPQSY