Protein Info for GFF3349 in Variovorax sp. SCN45

Annotation: Branched-chain amino acid ABC transporter, substrate-binding protein LivJ (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 38 to 366 (329 residues), 211.4 bits, see alignment E=4.5e-66 PF13433: Peripla_BP_5" amino acids 45 to 385 (341 residues), 65 bits, see alignment E=1e-21 PF01094: ANF_receptor" amino acids 56 to 333 (278 residues), 82.5 bits, see alignment E=4.8e-27

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 70% identity to bge:BC1002_5877)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>GFF3349 Branched-chain amino acid ABC transporter, substrate-binding protein LivJ (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MPLLSRHRFLRHVAVLSAALLATPLAALAAAATGEPVWFGVSGPLTGQNAQYGAQWKAGF
DLALEHINAQGGIQGRPLAYNFEDSQSDPRQSVAIAQKLVNDKRVLIELGDFSSPASMAA
SPIYQRAGLVQLGFTNSHPDFTKGGDYIWSPSISQADAQPLLAELAVKTLGFKRIAVLYL
NTDWGRTSKDVLVKAAQERGAQVAIAEGYQPDEKDFRSTLVRVRDANPDGLVLISYYPDG
ALIAGQVRSVGLRQPIAAVGSVYSPKFIELGGASVNGIFTNTAFYPDEPRAEVQDFVKSF
RAKYNKEPDAFNAYAYDAVVYAAAALRQAGANADRKAVRDAFYKIKDVPSVIFGKASFDA
QTRRIIGVKSVNLVVKDGKWAQLDEKAAVAAAR