Protein Info for GFF3347 in Xanthobacter sp. DMC5

Annotation: Glucans biosynthesis glucosyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 402 to 427 (26 residues), see Phobius details amino acids 455 to 478 (24 residues), see Phobius details amino acids 499 to 523 (25 residues), see Phobius details amino acids 564 to 590 (27 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 137 to 314 (178 residues), 41.4 bits, see alignment E=2.2e-14 PF13506: Glyco_transf_21" amino acids 212 to 378 (167 residues), 29.4 bits, see alignment E=7.8e-11 PF13632: Glyco_trans_2_3" amino acids 231 to 441 (211 residues), 62.3 bits, see alignment E=8.7e-21

Best Hits

Swiss-Prot: 55% identical to OPGH_RHOP5: Glucans biosynthesis glucosyltransferase H (opgH) from Rhodopseudomonas palustris (strain BisA53)

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 70% identity to sno:Snov_3589)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (707 amino acids)

>GFF3347 Glucans biosynthesis glucosyltransferase H (Xanthobacter sp. DMC5)
MDALTNAAPAARLAPEPALPPEAPLAMPAQDFRRAPQRVRSGTRLRASLIARRAFVFGGA
IALTGLAAYEMYKVLDVGGLTYLEYAVLVLFVVLFAWIGLAFTNALGGAISLLSGRKALD
IDPDAPLPSPTIRTALLMPCYNEEPHRVFAGLEATWRSLEATGRGDLFDVFILSDTTDPD
VWVAEEAAFLALRRRTGGCFHYRRRAQNTDRKAGNIADWVTRFGAAYEAMLILDADSVMT
GDCMVRLADALERTPDGGLIQTLPVIVGGRTLFARLQQFAGRLYGPLIAQGLSWWHGPQS
NYWGHNAIIRTRAFAQAAGLPHLKGRKPFGGHILSHDFVEAALLVRAGWGVYMVAGLPGS
YEEGPPSLTDLAVRDRRWCQGNLQHAAVLPVRGLSAASRIHLLTGIGSYVSAPLWLLMLL
AGLLTSLQARFVPPDYFPSGFALFPVWPAQDPVRAAWVFGGTMAVLLMPKFIAFALMLGD
GTARRGFGGGGRTFLGMISEILLSGLMAPVTMVSQSYAVVSILMGRDGGWNPQRRDDGSL
GWQEAFRHFWPHTLLGLGFAASTAAIAWPLMAWMSPVILGLLTAVPLAVWTSRPRRPGGL
LSTPEAQQPPPVLRAATDLRAVLTGPDGPAEAVARLAGDADLLAFHRNELPAQGKRLPGD
IRPDRLVARAKIEDARSRGEALALLSPREKAAALADNQALARLLALT