Protein Info for GFF3343 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 309 to 334 (26 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 357 (336 residues), 60.6 bits, see alignment E=6.8e-21

Best Hits

KEGG orthology group: None (inferred from 90% identity to xau:Xaut_3349)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>GFF3343 hypothetical protein (Xanthobacter sp. DMC5)
VTAPATAARTDGKAFSLAILVVAEVAAMATWFATTASLGAIRAQWSLSPFQEALLTSSVQ
AGFVAGTLLSALLSLADRADLRTLFSVSALVAALANGAILLFEPTHPAVPLLRFLTGMCM
AGVYPVGMKLAATWAKGDLGLLIGMLVAALTLGSASPHAMAAMGGLDWRAPVAGAAASAL
LAALLIRFAKVGPNHAKAPPLKLSNALDAFRRPALRLANLGYFGHMWELYAMWAWIGAFF
AASFAARYRDAPPLDPRLATFCVVAIGAVGALGGGFAADRLGRTFVTALSMAVSGLCAAG
IGFLFGASIWLVLPLALVWGVTVISDSAQFSAAVTELSDRSLIGTMLTVQTCVGFLITLV
SIHLLPYAVDAFGWRFAFLILAIGPFLGVLAMLRLRLRPEAATMAGGRR