Protein Info for GFF3340 in Xanthobacter sp. DMC5

Annotation: putative acrylyl-CoA reductase AcuI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family
  • amino acids 7 to 328 (322 residues), 426.6 bits, E=2.4e-132
• PF08240: ADH_N
  • amino acids 32 to 118 (87 residues), 44.8 bits, E=1.3e-15
• PF00107: ADH_zinc_N
  • amino acids 162 to 274 (113 residues), 59.5 bits, E=3.4e-20

Best Hits

Swiss-Prot: 52% identical to ACUI_RHOS4: Acrylyl-CoA reductase AcuI (acuI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_3346)

MetaCyc: 54% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• acrylate degradation II (3/3 steps found)
• ethanol degradation II (3/3 steps found)
• 3-hydroxypropanoate cycle (10/13 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• salidroside biosynthesis (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• ethanol degradation I (1/2 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• phenylethanol biosynthesis (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• serotonin degradation (4/7 steps found)
• L-methionine degradation III (1/3 steps found)
• pyruvate fermentation to ethanol I (1/3 steps found)
• pyruvate fermentation to ethanol III (1/3 steps found)
• glyoxylate assimilation (8/13 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.3.1.84

Protein Sequence (328 amino acids)

>GFF3340 putative acrylyl-CoA reductase AcuI (Xanthobacter sp. DMC5)
MSTETFRALMARKTDAGQAIAIETITEADLPAGDVTVDVEYSSFNYKDGLALKGMSRILR
ALPMVPGIDFAGTVRASDNPGFAPGDKVVLTGWGVGENWSGGFAERAKVKGEWLVKLPAS
LTPRQAMAIGTAGLTAMLCVDALERYGITEGGDVLVTGAAGGVGSVAVRLLSRLGYKVSA
LTGRPAEADFLKSLGATDIVDRATYAAAGKPLAGERWHGAVDTVGGTILANVLAATRYGG
AVAACGLASATDLPTTVFPFILRNVALLGVDSVNCPTPRRLAAWTRLGELLTEADFDLVT
REVTLEDLPQVAEDIIAGGVRGRTVVRI