Protein Info for GFF3328 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details PF00892: EamA" amino acids 10 to 144 (135 residues), 65.8 bits, see alignment E=2.5e-22 amino acids 160 to 301 (142 residues), 54 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 36% identity to ank:AnaeK_1695)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF3328 hypothetical protein (Xanthobacter sp. DMC5)
VAAQGKAPLSAILALLATALLWGSNHAAARAIHDALPLPSLVFWRWAIALALLLPIALPG
LLRERSAIRRNAGRIALLGLVGVGLFSVCLYAGAYLSPALEVGLLNATTPIWVLLIATFV
GRARPRFAQIAGILIAMVGVTLVLMKGLPAELQGFHFGAGNLASIAAAVLFAVYTYSLGQ
NPIGISALSLTALTALAGFVLVFCPVYAVFLCLGGQDPFTSGLKLEPVTLAVLYIAAGPT
LLGNLFWIYGAARVGAARAGPFLYFSPLATIALSATLLGETIMPIQIAGGAAILAGLWIS
TRAGSGPLRPASEARQGTPSP