Protein Info for GFF3327 in Sphingobium sp. HT1-2

Annotation: Cell-division-associated, ABC-transporter-like signaling protein FtsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR02673: cell division ATP-binding protein FtsE" amino acids 4 to 218 (215 residues), 285.4 bits, see alignment E=1.4e-89 PF00005: ABC_tran" amino acids 21 to 168 (148 residues), 117 bits, see alignment E=9.7e-38

Best Hits

Swiss-Prot: 44% identical to FTSE_SHIFL: Cell division ATP-binding protein FtsE (ftsE) from Shigella flexneri

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 95% identity to sch:Sphch_2354)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>GFF3327 Cell-division-associated, ABC-transporter-like signaling protein FtsE (Sphingobium sp. HT1-2)
MSAIVQFENVGLRYGLDSETLSDVSFSLNSGDFYFLTGSSGAGKTSLLKLLYLAQRPSRG
VIRLFGEDVVTLPRKRLPGFRRRIGVVFQDFRLVPHLSAYDNIALPLRVAGMEESEIDAP
VSEMLNWVGLGDRGQARPATLSGGEQQRVAIARAVIGRPEILVADEPTGNVDADMARRLM
TLFEALNRLGTTIVVATHDLPLMAQVASAQMMRLDKGRLADPTGALRYPPRPQGGA