Protein Info for GFF3326 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 76 to 101 (26 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 262 (170 residues), 96.5 bits, see alignment E=8.2e-32

Best Hits

Swiss-Prot: 32% identical to RIBX_CHLAA: Riboflavin transport system permease protein RibX (ribX) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 35% identity to bpa:BPP0637)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>GFF3326 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MTAAAPFWRSVYDFLEGRSRAAGLLRMLISLAFVLAVWQVLATYVVTNKLLLVPPAEVFR
ALAKESGNGALWTNALATVSAVAASFPVAVLIGVAIGLALASSRLLALTAGPMLTALNSV
PLVALAPLFIAWLGLGFASKFVLVTIFTIFPVLVTTETGLKATDKILIEAARSFNASRWQ
VFTTVTLPFAVPFIVSGIRVAWARALVAIIIAEFFGSFAGFGFAILAAGQSFDTATLLAY
VIMLGALGLMGSIFFEWLERRLAPWRQE