Protein Info for GFF3326 in Sphingobium sp. HT1-2

Annotation: Cell-division-associated, ABC-transporter-like signaling protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 152 to 194 (43 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details PF02687: FtsX" amino acids 178 to 296 (119 residues), 26.5 bits, see alignment E=3e-10

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 76% identity to sch:Sphch_2353)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF3326 Cell-division-associated, ABC-transporter-like signaling protein FtsX (Sphingobium sp. HT1-2)
MAGGNRRSAAAARHRLLPAGRVAGPMPWIIAIMMFLTVLAAAAGLGLGTAVRAMSADLAG
RATVQVVEADAQQRDRLSARVQQALRGNRDVRQVAPVPAATLAQQLRPWLGADVTSGDLP
IPALIDVSLTPGNAAAKVDRLRRSLATLSPSLRVEPHAAFLAPLAGLLTALGWLSGGLVL
LMGLATGAVVVLAARGAHDSHRTTIEVLHLMGATDVQIARLFQRRIALDATMGGALGFSF
AVLVILLIGARLSATGSQLMGAVALPWTSWALLAALPIAGILLSTLTGRWTVLRALGRSL