Protein Info for GFF3323 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative curli production protein CsgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF10610: Tafi-CsgC" amino acids 5 to 103 (99 residues), 167.5 bits, see alignment E=3.2e-54

Best Hits

Swiss-Prot: 100% identical to CSGC_SALEN: Curli assembly protein CsgC (csgC) from Salmonella enteritidis

KEGG orthology group: K04336, curli production protein (inferred from 99% identity to sty:STY1182)

Predicted SEED Role

"Putative curli production protein CsgC" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF3323 Putative curli production protein CsgC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHTLLLLAALSNQITFTTTQQGDIYTVIPQVTLNEPCVCQVQILSVRDGVGGQSHTQQKQ
TLSLPANQPIELSRLSVNISSEDSVKIIVTVSDGQSLHLSQQWPPSAQ