Protein Info for GFF3318 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13302: Acetyltransf_3" amino acids 3 to 132 (130 residues), 44.1 bits, see alignment E=1.2e-14 PF13480: Acetyltransf_6" amino acids 3 to 115 (113 residues), 26.8 bits, see alignment E=1.8e-09 PF00583: Acetyltransf_1" amino acids 36 to 131 (96 residues), 74.8 bits, see alignment E=2.4e-24 PF13673: Acetyltransf_10" amino acids 41 to 135 (95 residues), 51.7 bits, see alignment E=3.2e-17 PF13508: Acetyltransf_7" amino acids 46 to 132 (87 residues), 56.5 bits, see alignment E=1e-18 PF13420: Acetyltransf_4" amino acids 46 to 143 (98 residues), 27.9 bits, see alignment E=8e-10 PF08445: FR47" amino acids 74 to 133 (60 residues), 29.8 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 81% identity to vpe:Varpa_0034)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>GFF3318 no description (Variovorax sp. SCN45)
MRRLATPEDIDTVFALYMHEKVVPYLGYDPMPLEDFRPIYRQLLDGRDFFVYERDGRIAG
FYRAARYPGRVRHVASLGTLAVDPALHGQGIALAMVTDAIERLKSDGVKRIELIVESDNA
PALRFYQKLGFEREGTLRKFYKRASDAEAIDDHMMALLVD