Protein Info for GFF3318 in Sphingobium sp. HT1-2

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 360 (343 residues), 163.1 bits, see alignment E=4.5e-52

Best Hits

KEGG orthology group: None (inferred from 86% identity to swi:Swit_5128)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF3318 Uncharacterized MFS-type transporter (Sphingobium sp. HT1-2)
MTDRTSSPAYRGVVLAMLLLVYTFNFLDRQILGILAGPIKAELGLTDTQLGALGGIAFAL
LYSTLAIPLALLADRTSRTWIITVSLAIWSGFTALCGMAGNFMQMFLFRIGVGVGEAGGV
APSYAVISDYFPQHQRARALSIYSLGIPLGSAGGVLLGGYIAQTVEWRTAFIAVGIMGIL
IAPLFRLVVREPARPVQSGTPVPVSAVFGILAAKRSFWFLALGAACSSMCGYGVAFWLPS
LLMRSFGLDLMGAGQFLGGLLLLGGVAGVLLGGFLGDAMGNRDKAWFAWVPAISYVIGMP
LFVVGVMSSSVSFAFALFLIPQALVYVWLGPVLTAVQHLVPPHMRASASATFLLINNLVG
LGLGSWSVGALSDALTPTYGQEALRYAIVAALGFYLLAGLFMALAGKALRKDWVTA