Protein Info for GFF3317 in Xanthobacter sp. DMC5

Annotation: Oligosaccharides import ATP-binding protein MsmX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF00005: ABC_tran" amino acids 22 to 163 (142 residues), 114.5 bits, see alignment E=1.2e-36 PF17912: OB_MalK" amino acids 237 to 289 (53 residues), 36.7 bits, see alignment 1.3e-12 PF08402: TOBE_2" amino acids 282 to 358 (77 residues), 41.5 bits, see alignment E=2.3e-14 PF03459: TOBE" amino acids 303 to 352 (50 residues), 25.5 bits, see alignment 2.5e-09

Best Hits

KEGG orthology group: K10112, maltose/maltodextrin transport system ATP-binding protein (inferred from 75% identity to met:M446_1314)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF3317 Oligosaccharides import ATP-binding protein MsmX (Xanthobacter sp. DMC5)
MAVVKLDKIMKRYGGGGPVVVEDVDLTIDDGEFMVLLGPSGCGKSTTLRMIAGLESISGG
TLSIDGRVVNDVPAKDRDIAMVFQSYALYPHMSVADNLAFGLRRRSIPAGEIERRVKEVA
ALLGLAPLLARKPSALSGGQRQRVALGRAMVREPQVFLFDEPLSNLDAALRVNTRSEIIK
QHHRLGSTMIYVTHDQVEAMTMGTRICVMNAGKVAQIGAPLDVYWQPANTFVARFLGSPP
MNLMDATLAAATRRASSPALDAPLARWSDGVLQARDGRKVTLGVRAEDMAIDPAALDGAP
GGRVTGRTIAVEPLGAETLLLLELPGGGEITARLPRHVTAAPDQEVELFFRADAAYLFDA
KTGDAITPLETGAAAVRAAVQRRTH