Protein Info for GFF3316 in Xanthobacter sp. DMC5

Annotation: Diacetylchitobiose uptake system permease protein NgcG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 270 (174 residues), 66.3 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 32% identical to YURM_BACSU: Probable ABC transporter permease protein YurM (yurM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 85% identity to met:M446_1315)

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF3316 Diacetylchitobiose uptake system permease protein NgcG (Xanthobacter sp. DMC5)
MAASLAAASGRAPLPRLFSRGILALVLGVYTIYQLGPFLWLATMSVRTTAEISADPYAWP
SPMHLDQFRTAWVDSDFATYFWNSTMVVVGAVAVLTFIGAAAAHALARYRFRGNRLIYGI
LFSSIIFPPQITLISLYQILVDYNLYNSLFGLALVYISLQLPLTVYLLEGFFARIPQDLF
DAAKMDGYGDLEIFWRIVLPVGMPAIATTLILNFIQLWNEFLFAVVLITDPDKRTLPIGI
RAFMGDHFQDIGMIATGVMISVIPVIVVYVFFSEKLIRGMTAGAIK