Protein Info for GFF3315 in Xanthobacter sp. DMC5

Annotation: Lactose transport system permease protein LacF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 178 to 204 (27 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 107 to 315 (209 residues), 58.1 bits, see alignment E=4.9e-20

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 80% identity to met:M446_1316)

Predicted SEED Role

"ABC transporter sugar permease protein ycjO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF3315 Lactose transport system permease protein LacF (Xanthobacter sp. DMC5)
MPDAISLRTAAKSGEAKASSRATLADPRRATRLVLAIFLGPALLVYCGLTAYPAFRTIYD
SFFTIEGMDATFVGLANYRDLMGDETFWVAVRNTFIWSFVAPVIDVATGLLLALALYAGV
PFARFLRVAWFTPVLLSYVVVAILWMWIYNYDWGVLNVMLRAVGLGDLASSWLGDPNLAL
AAVIVTHAWKWAGFNMVVCLAAIHSLPKEVLEASDLDNCGWGAKLRYIIIPMLRPTLLSL
YILSFIGKMKVFDLVWIMTQGGPLWATETVSTYVYKRAFNWNTFDLGYPSAIATVWFLVV
CAAVIILNRVLGSRERLEY