Protein Info for GFF3314 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF01547: SBP_bac_1" amino acids 56 to 353 (298 residues), 69.2 bits, see alignment E=6.2e-23 PF13416: SBP_bac_8" amino acids 61 to 359 (299 residues), 78.4 bits, see alignment E=8.1e-26

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 75% identity to met:M446_1317)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, sugar-binding protein" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>GFF3314 hypothetical protein (Xanthobacter sp. DMC5)
MTSIRGGRASGWGFGRGISRGLCAAVAVAAAMGGGHAFAQTEITMWSNWPDEPAKKEWVT
ARVKEFEAANKQCTVKLSFIPKADIYTQAKSAVRTGQAPDIFYMEPDQPEFLAGGFLEPL
DGYIDLNGLEDWAKPAWTSKGKVYGVPVEAYTVELYYNKDLVKKVGVDVPASFQLTQAQF
TDLVKKGVAAGITPVSQGVGDRPFPGGQLLFESLLRKLGPDDYSKLLNGELSFKDPRVQE
VMTWVKELVDAGAYPKSFSTLKLGESHFYFYNSPGSLTFPDPSWFTGRAFAAPEKGGMPA
NFPLGIMKFPAMDKGACPNCKTLAVAGSFVMYSKGKNKDCAGALLKSIANAENGTKWISE
VSLQSGLKSDPAKIVSPHKAYFDELNARNKDVTYFFGTPLLYYRAKCAETYIQVMNNAFP
AGLISVADAAEKMDAACLKK