Protein Info for GFF3312 in Variovorax sp. SCN45

Annotation: Sensory histidine kinase CreC of two-component signal transduction system CreBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF00512: HisKA" amino acids 260 to 320 (61 residues), 51.1 bits, see alignment E=1.1e-17 PF02518: HATPase_c" amino acids 366 to 475 (110 residues), 86 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: K07641, two-component system, OmpR family, sensor histidine kinase CreC [EC: 2.7.13.3] (inferred from 95% identity to vpe:Varpa_0028)

Predicted SEED Role

"Sensory histidine kinase CreB" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>GFF3312 Sensory histidine kinase CreC of two-component signal transduction system CreBC (Variovorax sp. SCN45)
VTRRTRIFIGILLIYTAGIAFLLYRVVSDIDPRYRESAEESLVETSQLLASLVEQDVIAG
AINTARLEPLFRTAYAREFSAQIYNLHKSQVELRVYVTDRNGRVMFDSLGRHLGADYSQW
MDVSRTLAGLYGARTSRDVDGDPRTSVMYVGAPIRWNNEIVGMVSVGKPVQSFGQFVEDA
RARTLWVGVGSGLALLLLAVIVSVWLVRPFGLIRDYWTWVRAQRTLSLSRMVRRAIDGVR
SGFSEMRDALTGRNYVADYVQTFTHEVKSPLSAIRGAAELLQEPSMPHPERERFLKNIER
ETQRIQEIVDRMMELTALETRRALDRTEPVALASLIDDIAISAQPAAAKRNIRLLVNIRS
EASTEGDPFLLRRAISNLLDNAIDFSPRDSEVLLTLETTSRLARVSVRDHGPGIPEYAQE
KVFQKFYSLARPDSKKKSTGLGLAFVKEIAALHRGRIELGNASRGGAVATLTLPLLSHPG
RSH