Protein Info for GFF3310 in Xanthobacter sp. DMC5

Annotation: 3-hydroxy-3-methylglutaryl-coenzyme A reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00532: hydroxymethylglutaryl-CoA reductase, degradative
  • amino acids 9 to 385 (377 residues), 467 bits, E=3.1e-144
• PF00368: HMG-CoA_red
  • amino acids 22 to 385 (364 residues), 362.7 bits, E=1.1e-112

Best Hits

Swiss-Prot: 60% identical to HMDH_ARCFU: 3-hydroxy-3-methylglutaryl-coenzyme A reductase (hmgA) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K00054, hydroxymethylglutaryl-CoA reductase [EC: 1.1.1.88] (inferred from 75% identity to bpt:Bpet3342)

MetaCyc: 56% identical to 3-hydroxy-3-methylglutaryl-coenzyme A reductase monomer (Pseudomonas sp. mevalonii)
Hydroxymethylglutaryl-CoA reductase. [EC: 1.1.1.88]

Predicted SEED Role

"Hydroxymethylglutaryl-CoA reductase (EC 1.1.1.34)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.1.1.34)

MetaCyc Pathways

• mevalonate degradation (2/2 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (6/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (3/7 steps found)
• mevalonate pathway II (haloarchaea) (3/7 steps found)
• isoprene biosynthesis II (engineered) (3/8 steps found)
• mevalonate pathway III (Thermoplasma) (3/8 steps found)
• mevalonate pathway IV (archaea) (3/8 steps found)
• superpathway of ergosterol biosynthesis I (5/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)
• superpathway of cholesterol biosynthesis (5/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.34 or 1.1.1.88

Protein Sequence (427 amino acids)

>GFF3310 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Xanthobacter sp. DMC5)
MTIAAGSNRSSRIAGFHKLSPRERLDLVAGFAGLDEATVTHLANMGNLDPVLADKLIENV
IGTMNIPVGVATNMKIDGEDVLIPMATEESSVVAAVCNAAKQNYETGFFTSVSGNLMIAQ
VQAVDVADPAGARIRILEKRDEIKAACDACDPVLVSLGGGFRDVEVRLLDTPSGTMVVTH
LIVDTRDAMGANAVNTMAEKLAPAIAAWSGGRVYLRILSNLADRRLARARAVWKAADIGG
EAVRDGMISAYEFAAADPYRAATHNKGIMNGISAVVLATGNDTRAVEAGAHAFAARSGRY
TSLTTYEVDKDGNLSASIELPLAVGLIGGATKVHPTARACLAILGVTTAERLARIIAAVG
LAQNFSALKALATTGIQKGHMALHAQNIAMMAGAVGEEIDRVARLLVERASVRMDVAQKV
LEEVRGG