Protein Info for GFF3308 in Sphingobium sp. HT1-2

Annotation: Exported protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 640 to 655 (16 residues), see Phobius details PF05170: AsmA" amino acids 42 to 167 (126 residues), 30.1 bits, see alignment E=1.1e-11 amino acids 309 to 568 (260 residues), 65.3 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: K07290, hypothetical protein (inferred from 78% identity to sjp:SJA_C1-34510)

Predicted SEED Role

"FIG01094795: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>GFF3308 Exported protein (Sphingobium sp. HT1-2)
MAEVEPVPPSASKPAQPGGAAVYLRRARDRWRALPLPARILLWIIGILFAVWLILFITKG
RFLKGPFERILSARLERQVQVGGDFQLYFAPIAIKFRAEGMRIANLPWASRPDLLRADLI
DARIAPLSLIFGSRYRIPWLELRGAAADLEWSRDRQHNTWTLGDPDRKGEPMTLPLVRRA
LLAGTTMRYRDPVLMLSTDIGFETVKAQDTRFASDVRLSGTGTMRGKPFTLKGGLLSPNA
TVTGGKNSLALRAQAGATVLEVTGTLPGATELEGSDLRVVAQGPNLSHLFDFLGVAIPGT
RHYRFTAALTKAGEEWRFTHLQGRFGASDLAGRFTVSLPNNRLQLDADLATQRLDIIDVG
PFIGYDPQRLDAQGGAGAITTVQGTPRLLPDAPLRIEAIRNFDANVRYSVKTIRAPNVPI
ANAAMTLKLDHSLLTLSPLTFDMAGGHVASDIEINARNQPVRTSYDVRLAPTPMGTLLAR
WGVEQSGTTGMVKGRMQMTGLGDTVHDSLATANGRIAVILPAGSMWARNVQLSEIDVGTF
ITKMFEKKLKDPVQINCGLIAFTVRDGVAAADPILIDTRKNVMIGRGGFSFRNESLDLAF
RADGKKISLFSGQSPVGIGGYFARPSINVISPDLIARGGAAAALGIVATPIAATLAFVDV
GDAKAAACGPVLAGADAAAQRTRGGKPRDDVGRGTTAKDEAGKGSKAEKKAQDKKFLGIF