Protein Info for GFF3307 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF00903: Glyoxalase" amino acids 13 to 130 (118 residues), 64.9 bits, see alignment E=1.4e-21 PF22656: At5g48480-like_N" amino acids 15 to 42 (28 residues), 27.7 bits, see alignment 2.8e-10 PF18029: Glyoxalase_6" amino acids 20 to 130 (111 residues), 25.8 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 47% identical to Y911_MYCBO: Uncharacterized protein Mb0911c (BQ2027_MB0911C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 54% identity to bsb:Bresu_1545)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>GFF3307 hypothetical protein (Sphingobium sp. HT1-2)
MSDTPFVLPGVTPHLTIADGKAADAIAFYTAAFGATEQSRHLEEDGTRLMHAHLTINDGG
LMLNDHFPEMCGGAPAEKPAAVTLHLEVDDADRWWDRALAAGAAIRFPIDNQFWGARYGQ
LTDPFGHVWSIGGPIRD