Protein Info for GFF3306 in Xanthobacter sp. DMC5

Annotation: D-galactarolactone cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF02746: MR_MLE_N" amino acids 14 to 125 (112 residues), 68 bits, see alignment E=8.7e-23 PF13378: MR_MLE_C" amino acids 151 to 372 (222 residues), 237.7 bits, see alignment E=1.3e-74

Best Hits

Swiss-Prot: 47% identical to GCI_AGRFC: D-galactarolactone cycloisomerase (gci) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 54% identity to sno:Snov_4076)

MetaCyc: 47% identical to D-galactarolactone cycloisomerase monomer (Agrobacterium fabrum C58)
RXN-15902 [EC: 5.5.1.27]; 5.5.1.27 [EC: 5.5.1.27]

Predicted SEED Role

"mandelate racemase/muconate lactonizing enzyme family protein" in subsystem Catechol branch of beta-ketoadipate pathway

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF3306 D-galactarolactone cycloisomerase (Xanthobacter sp. DMC5)
VSVIKSVRAHVMAAPVEKPFTSSRGWLYKTRGTCLVEIETADGIVGWGECYGPSAVAKAF
IETQFGPRILGRDPFDVEVIWEDLYNRIKDYGNKGMSIAAISGIDIALWDIIGKSCGKPV
HKLLGGAFRTEVDCYATGLYFTDFDRLVEEAVEEAAGYVDEGFKAIKMKIGLGNITKDYE
RVKAVREAIGPNIRLMVDANHAFSVPVAIRLGRKLEELDVEWFEEPISPEDIDGYVEVSR
ALDMAVAGGENEFTRWGFRDAIVRKAMDIVQPDVCAAGGLSECKKIAALASTHGVECVPH
AWGSAVGIAATLHFLGSLADQPPSLFPFEPLLEFEQCENPFRDHLATEPIVQERGRVKIP
TGPGLGIEIDRSVIDRYRVG