Protein Info for GFF3306 in Sphingobium sp. HT1-2

Annotation: O-acetyl-ADP-ribose deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to Y2219_CHLTE: Macro domain-containing protein CT2219 (CT2219) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: None (inferred from 66% identity to mes:Meso_0923)

MetaCyc: 58% identical to 2'-O-acetyl-ADP-ribose deacetylase, regulator of RNase III activity (Escherichia coli K-12 substr. MG1655)
RXN0-7013 [EC: 3.1.1.106]

Predicted SEED Role

"COG2110, Macro domain, possibly ADP-ribose binding module"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>GFF3306 O-acetyl-ADP-ribose deacetylase (Sphingobium sp. HT1-2)
MMVGTTRWDVVTGDITRCAVDAIVNAANNSLLGGGGVDGAIHRAAGPELLEECRGIGCCP
TGEARITRGYRLPARYVIHTVGPIWQGGNQGERDLLANCYSHSLSLVRHYGLRAVAFPAI
STGVYGYPRAQAAKVAARAVAEALRRDPDAFDQILFVCFDEDNRDLYDAAVRDAVAGD