Protein Info for GFF3303 in Xanthobacter sp. DMC5

Annotation: D-galactarolactone cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 95 to 111 (17 residues), see Phobius details PF02746: MR_MLE_N" amino acids 21 to 128 (108 residues), 72.9 bits, see alignment E=2.6e-24 PF13378: MR_MLE_C" amino acids 151 to 365 (215 residues), 205.8 bits, see alignment E=7.3e-65

Best Hits

KEGG orthology group: None (inferred from 57% identity to reu:Reut_C5897)

Predicted SEED Role

"mandelate racemase/muconate lactonizing enzyme family protein" in subsystem Catechol branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>GFF3303 D-galactarolactone cycloisomerase (Xanthobacter sp. DMC5)
MRIASVRAVPVSFRVPEGKNVTLGIGRAVKRDAVLVRVETDDGLVGWGEAHHGRCPGAVA
KLIDTTLSELVLGMDALDVVGVWQKVYRMQLASHGMGAAAALALSGLDIALWDIRGKAMN
APIHRLLGGAPKKIKAYAGGISLGWQDPAALAEEAQSYVAQGYRALKLRVGDTPRRDIAR
VEAVRAAVGDDIDILVDGNTGCSLDDVRRVMPAYQAAKVGWFEEPFPPHDYRSYLDATKL
GTVPLAAGENHYTRFEFTRLIADGAVAFVQPDLSKAGGITECHRIAVLASAWKMSVNPHT
SATGINMVATLHLMCAVDNPGYFEGDVAHHNPFRDEVCGLPYQLSPDGTVTCREGPGLGI
EVDEAFLAAHPLIEGPCYV