Protein Info for PS417_16905 in Pseudomonas simiae WCS417

Annotation: UDP-2,3-diacylglucosamine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 2 to 198 (197 residues), 40.1 bits, E=5.7e-14
• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 3 to 231 (229 residues), 341.2 bits, E=1.2e-106

Best Hits

Swiss-Prot: 99% identical to LPXH_PSEFS: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 99% identity to pfs:PFLU3874)

MetaCyc: 46% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (17/25 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

See U1U9W2 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PS417_16905 UDP-2,3-diacylglucosamine hydrolase (Pseudomonas simiae WCS417)
MILLISDLHLEEERPDITRAFLDLLHTRARGAQALYILGDFFEAWIGDDGMTPFQRSICA
ALRELSDSGTPIFIMHGNRDFLIGKAFCKAAGATLLKDPSVVQLHGEPVLLMHGDSLCTR
DVGYMKLRRILRNPIVLFILRHLPLSTRHKLARKLRSESRAQTRMKANDIVDVTPEEVPR
VMQQFAVRTLVHGHTHRPAIHKLQIGDQAAKRIVLGDWDKQGWALQVDEQGFQLAAFDFV
NPQLALPGA