Protein Info for GFF330 in Variovorax sp. SCN45

Annotation: Nucleoside ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 240 to 266 (27 residues), see Phobius details amino acids 285 to 315 (31 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 341 (281 residues), 134.2 bits, see alignment E=2.5e-43

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 97% identity to vpe:Varpa_3252)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF330 Nucleoside ABC transporter, permease protein 1 (Variovorax sp. SCN45)
MMRLEKRHQTSRAALVLAPIGAVVFTMIVSALLVLWAGAPVGRTYALLLQGGFGSVFAWS
ETLTRAIPLILTGLAATVAFKARLFNIGSEGQLYAGALAAVAVGGMHGGTGFELSPWLLF
PLMMLAAAVAGALMLLGPALMKNKLGVDEVVTTLLINFIVLLGVSALLDGPMKDPTAMGW
PQSVSLQSDLELGKLVAQTRVHTGLLWAVSLAVMVWAVFKYTVLGFDIRAVGANARAAAF
AGVPVTRTVVMVALLSGALAGLAGAIEVAGRTSYVTLDMSPGYGYTGIVIAMLAGLHPLG
VIAAGVFVAGVLVGADTMSRAVGVPTYIADVIVAASLIAVLVATLLTQYRVRMKK