Protein Info for GFF3299 in Xanthobacter sp. DMC5

Annotation: Iron-sulfur cluster carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF01883: FeS_assembly_P" amino acids 10 to 80 (71 residues), 48.5 bits, see alignment E=2.7e-16 PF10609: ParA" amino acids 120 to 363 (244 residues), 344.8 bits, see alignment E=7.9e-107 PF13614: AAA_31" amino acids 122 to 160 (39 residues), 37.7 bits, see alignment 6.4e-13 PF09140: MipZ" amino acids 123 to 244 (122 residues), 30.8 bits, see alignment E=5.6e-11 PF01656: CbiA" amino acids 124 to 342 (219 residues), 50.8 bits, see alignment E=4.8e-17

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 90% identity to xau:Xaut_3327)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF3299 Iron-sulfur cluster carrier protein (Xanthobacter sp. DMC5)
MMSHTAELSEDTVRSTLAKVRTPEGVALSVSPALAGVVVTSGKVYLSINIDPAQARAWED
VRIAAENAVKALPGVASALVTLTAERKQAPAAPAPAAHNHGHGHAHGGAPAPRGIAVPGV
ASIIAVASGKGGVGKSTTSINLAIALRDLGLKVGLLDADIYGPSVPRLTGVAQKPETTPD
GKTMLPLENFGLQLMSIGFLVEEDTPMIWRGPMVMSAISQMLKDVKWGPLDVLVVDMPPG
TGDAQLTMAQQVNLAGAVIVSTPQDLALIDARRGVAMFERVNVPILGVVENMAYFVCPHC
GGRSDIFGHGGAHAEADKLGVPFLGEIPLHMRIREMSDAGLPILVSDPESPQSAAYRHVA
TGVKAALDKATAQSRQAPRIVIE