Protein Info for GFF3295 in Xanthobacter sp. DMC5

Annotation: Proline/betaine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 66 to 89 (24 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 127 to 154 (28 residues), see Phobius details amino acids 168 to 195 (28 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 333 (300 residues), 95.2 bits, see alignment E=4e-31 amino acids 253 to 425 (173 residues), 50.9 bits, see alignment E=1.1e-17 PF00083: Sugar_tr" amino acids 34 to 220 (187 residues), 63.2 bits, see alignment E=2.2e-21 amino acids 255 to 435 (181 residues), 39.7 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 48% identity to azc:AZC_1031)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>GFF3295 Proline/betaine transporter (Xanthobacter sp. DMC5)
MTATDAGTRDLPGIRPPGASNPGGSSPRLLAAGAIGNVLEWYDFASYGFLAPIFARTFFP
AEDAQVGLISAFGLFGAAFLMRPLGAILFGHVGDRFGPRIALIVSVSVMSCATVGIGLLP
TYATAGFLAPLLLLILRLVQGLSIGGEYTTSAIYLAEHAVPRHRGLTAAFSTAGGQTGTL
IGSGVCALLSALLSAEAMQAFGWRVPFLLGAVLGITALVLRRPRPGDRGGSKARGLPLTR
AFREAGGSIIAAMLVTLFIGADTYLLFVYLPTYIEQEAGLAPATALAFTTLGLIVSGTCC
LLFAALSDRIGRRRIVAAGLAGFVVLSWPLFLLLRGGSPGEVLAAQLVFSVMAAAVTSPM
PALLVELFETPVRCSAIGFAWNLGIGVSGGLAPMLATYFVTGLGLTMAPAVHLMLLAAVA
LVGVGSLTERRGRVLDGPADWP