Protein Info for GFF3294 in Xanthobacter sp. DMC5

Annotation: Proline/betaine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 33 to 220 (188 residues), 91.2 bits, see alignment E=7.3e-30 amino acids 265 to 434 (170 residues), 50 bits, see alignment E=2.2e-17 PF07690: MFS_1" amino acids 34 to 378 (345 residues), 88.2 bits, see alignment E=5.3e-29

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 50% identity to azc:AZC_1030)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF3294 Proline/betaine transporter (Xanthobacter sp. DMC5)
MSSITRTHAGGVADGATPQGVPVLSRRLMAAGMLGNVLEWYDFAVYGFLASIFARNFFPE
SSPTAAMLSVFGVFAASFLMRPLGSVLFGHIGDRLGRRAALMSSAALMSISTFCVGLLPT
YETAGVFSAVLLLVLRLAQGLSVGGEYMTSAVFLAENAQVRWRGAVTSLAVVGCNGGILL
GSVVGAMVSGLMSTDDLAAWGWRIPFLLGCLLGGFALVLRRAVARDVKRVHRPSLPVVEA
FRENGGGILRATLINIVLGIAFYLAFVYLTTWLQQADHFTPHVALELNAVSMAVVMAACL
GFAALSDRIGRKPLIAGGFLALAVFSWPLFLLLQSGSTGLALLGQLGFAVIVSIYGGPMA
VTLAEMFPRHTRCTAMGLSWNLGVGLGGGTAPMVAVLLVSLTGNTMAPAFYLIVGGVVAF
LAALGLKETRGQPLD