Protein Info for GFF3293 in Sphingobium sp. HT1-2

Annotation: Porphobilinogen deaminase (EC 2.5.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF01379: Porphobil_deam" amino acids 8 to 213 (206 residues), 239.7 bits, see alignment E=2.4e-75 TIGR00212: hydroxymethylbilane synthase" amino acids 8 to 292 (285 residues), 301 bits, see alignment E=3.7e-94 PF03900: Porphobil_deamC" amino acids 227 to 297 (71 residues), 54.5 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 60% identical to HEM3_SPHAL: Porphobilinogen deaminase (hemC) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 79% identity to sjp:SJA_C1-03160)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF3293 Porphobilinogen deaminase (EC 2.5.1.61) (Sphingobium sp. HT1-2)
MKRPERPLRLGTRGSPLALAQAHMTAQALRDAHGWDQDAITTVIVQTSGDRIQDRALAEI
GGKALWTKELDRALAEGEIDCAVHSMKDVETIRPDAIRIAAMLPRADVRDRLVGAENFAA
LPPQPIVGTSSPRRAAQVKRLRPDAQIILFRGNVATRLAKLEAGEAHATLLAAAGLDRLG
QADIGATVEIDTMLPAPSQGAVGIETLADNDAMLGWLAAINHRDTFDCVMAERAVLRGLG
GTCHSPIAALALLEGGQIHLRAEIISPEGDETVRDEARLARGDFDAAEAIGRSLLERASP
ALRSLFEG