Protein Info for GFF3293 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Membrane protein, suppressor for copper-sensitivity ScsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF08534: Redoxin" amino acids 37 to 147 (111 residues), 51.7 bits, see alignment E=1.7e-17 PF00578: AhpC-TSA" amino acids 38 to 143 (106 residues), 48.4 bits, see alignment E=1.8e-16 PF00085: Thioredoxin" amino acids 57 to 150 (94 residues), 33.6 bits, see alignment E=6.5e-12 PF13905: Thioredoxin_8" amino acids 60 to 142 (83 residues), 34.8 bits, see alignment E=3.4e-12

Best Hits

Swiss-Prot: 41% identical to THIX_HAEIN: Thioredoxin-like protein HI_1115 (HI_1115) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 98% identity to spt:SPA1734)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsD" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>GFF3293 Membrane protein, suppressor for copper-sensitivity ScsD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAGKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFATTPLRTLTGESTTLATLSEER
PVLLYFWASWCGVCRFTTPAVARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVND
ANGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKLRLWWAKTF