Protein Info for GFF3291 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Membrane protein, suppressor for copper-sensitivity ScsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 277 to 302 (26 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 408 to 432 (25 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 479 to 500 (22 residues), see Phobius details PF11412: DsbD_N" amino acids 44 to 145 (102 residues), 58.1 bits, see alignment E=1.8e-19 PF28432: DUF8393" amino acids 167 to 264 (98 residues), 92.2 bits, see alignment E=3.3e-30 PF02683: DsbD_TM" amino acids 278 to 493 (216 residues), 93.2 bits, see alignment E=3e-30 PF13899: Thioredoxin_7" amino acids 513 to 599 (87 residues), 57.7 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: K08344, suppressor for copper-sensitivity B (inferred from 100% identity to stm:STM1114)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsB" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>GFF3291 Membrane protein, suppressor for copper-sensitivity ScsB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLEN
GWKTYWRAPGEGGVAPSIAWKGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGT
LPATLRGVLTLSTCSNVCLLTDYPFSVTPTVQNADFAHDYARAMGKIPLRSGLTDSLDVG
YRPGELVVTATRAAGWSSPGLYLDTVDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
RNKSLTLVLADGAIAQESTQTIGTAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPV
LGMKLGSILLVEEKSRSHIRRQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNV
WFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNGMSGHFWQGAFATLLATPCSA
PFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADWC
ITCKVNKYNVLQKEDVQAALQQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPG
LPEGEALPTLLTRDAVLQTLKKAKGITQ