Protein Info for PS417_16825 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF00892: EamA" amino acids 16 to 145 (130 residues), 54.9 bits, see alignment E=6e-19 amino acids 156 to 286 (131 residues), 41.7 bits, see alignment E=7e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU3862)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH52 at UniProt or InterPro

Protein Sequence (309 amino acids)

>PS417_16825 membrane protein (Pseudomonas simiae WCS417)
MTTPNSPSRFNRFSKAECILVVITMIWGGTFLLVQHAMTVSGPMFFVGLRFAAAAIVVGF
FSLRTLRDLTLFELKAGVFIGVAIMFGYGLQTIGLQTILSSQSAFITALYVPFVPLLQWL
VLGRRPGLMPSIGIMLAFTGLMLLTGPAGASLNFSPGEIATLIGAVAIAAEIILISAFAG
QVDVRRVTVVQLATASLLSFLMVVPMGEALPGFSWLLLFSAVGLGLTSAVIQVAMNWAQQ
SVSPTRATLIYAGEPVWAGVVGRIAGERFPPIAMVGAALIVAAVIVSEMKTKGQKALELR
DEREQEQQG