Protein Info for GFF3286 in Xanthobacter sp. DMC5

Annotation: Precorrin-3B C(17)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00590: TP_methylase" amino acids 4 to 213 (210 residues), 128.7 bits, see alignment E=1.6e-41 TIGR01466: precorrin-3B C17-methyltransferase" amino acids 5 to 248 (244 residues), 290.3 bits, see alignment E=5.8e-91

Best Hits

Swiss-Prot: 74% identical to COBJ_SINSX: Precorrin-3B C(17)-methyltransferase (cobJ) from Sinorhizobium sp.

KEGG orthology group: K05934, precorrin-3B C17-methyltransferase [EC: 2.1.1.131] (inferred from 87% identity to xau:Xaut_3282)

MetaCyc: 74% identical to precorrin-3B (C17)-methyltransferase (Pseudomonas denitrificans (nom. rej.))
Precorrin-3B C(17)-methyltransferase. [EC: 2.1.1.131]

Predicted SEED Role

"Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF3286 Precorrin-3B C(17)-methyltransferase (Xanthobacter sp. DMC5)
VSGRLTVVGLGPGAARQMTPEAAEAVAAADILFGYTPYLARLPERAGQERRASDNREEIA
RASAALEAAVAGAKVAMVSGGDPGVFAMAAAVCEAIEHGPAEWRALEVEIVPGVTAMLAV
AARCGAPLGHDFCAISLSDNLKPWPLVEKRLALAAEAGFVIALYNPISKARPWQLGRAFE
LLREKLPGSVPVVFGRAAGREDERIALATLAEADPARADMATCVLIGTTETRIVPRAGMS
PLVYAPRSAPAP