Protein Info for GFF3285 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional activator of 4-hydroxyphenylacetate 3-monooxygenase operon, XylS/AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR02297: 4-hydroxyphenylacetate catabolism regulatory protein HpaA" amino acids 6 to 291 (286 residues), 391.6 bits, see alignment E=1.1e-121 PF02311: AraC_binding" amino acids 33 to 141 (109 residues), 31.9 bits, see alignment E=1.5e-11 PF07883: Cupin_2" amino acids 39 to 99 (61 residues), 31.2 bits, see alignment E=2.3e-11 PF12833: HTH_18" amino acids 213 to 291 (79 residues), 72.4 bits, see alignment E=4.6e-24

Best Hits

KEGG orthology group: K02508, AraC family transcriptional regulator, 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein (inferred from 100% identity to sei:SPC_2642)

Predicted SEED Role

"Transcriptional activator of 4-hydroxyphenylacetate 3-monooxygenase operon, XylS/AraC family" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF3285 Transcriptional activator of 4-hydroxyphenylacetate 3-monooxygenase operon, XylS/AraC family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MCQRAIANIDISKEYDESMGSNDVHYQSFARMADFFGRDMQAHRHDQFFQMHFLDTGQIE
LQLDDHRYSVQAPLFVLTPPSVPHAFITESDSDGHVLTVREELVWPLLEVLYPGTREAFG
LPGICLSLADKPNELAALKHYWQLIERESTEQLAGCEHTLVLLAQAVFTLLLRNAKLDDH
AATGMRGELKLFQRFTLLIDNHFHQHWTVPDYACELHITESRLTDICRRFANRPPKRLIF
DRQLREAKRLLLFSDNAVNEIAWQLGFKDPAYFARFFNRLAGCSPSQFRQREVPSFLN