Protein Info for GFF3284 in Sphingobium sp. HT1-2

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 259 to 286 (28 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 143 to 368 (226 residues), 67.2 bits, see alignment E=7.6e-23

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 75% identity to sjp:SJA_C1-03070)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF3284 ABC transporter (Sphingobium sp. HT1-2)
MKELLRAASVIARRDFTAVVLSRTFILFLIGPLVPIIIGMVFAGFTQKISSTDLRPVVGI
AMAPADVGALERAHKRLTERMGPQALPRLHAVSPDTPPRILLARPESDVVAILSGTVSRP
VLTGKPEDLDRLQGDLSLIASAAQAEKVLHMVKVERQEVATSLGAQSQARLLIGRTGQIV
IFFLTILLAGMILSNLVEEKTNKIIEILAAAVPVDAIFLGKLIAMLGMSFVGIAFWGATA
FTIFMALKAPGTVLPDPAVGWPAFIALGILYFAMAYTLLGSLFLGIGAQAATVREVQTLN
MPITMGQMMIFFFVSYTVDHMGSPLEVASVVFPFSSPFAMIARAAQDAALWPHLVAILWQ
GVWVALIIRIGVLLFRRHVLKSGGRWWKQLFRSSTG