Protein Info for PS417_16805 in Pseudomonas simiae WCS417

Annotation: 5,10-methylene tetrahydromethanopterin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 7 to 434 (428 residues), 573 bits, see alignment E=1.8e-176 PF00296: Bac_luciferase" amino acids 30 to 388 (359 residues), 138.4 bits, see alignment E=1.7e-44

Best Hits

Swiss-Prot: 54% identical to DMOA_HYPSL: Dimethyl-sulfide monooxygenase (dmoA) from Hyphomicrobium sulfonivorans

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU3858)

MetaCyc: 54% identical to DmoA (Hyphomicrobium sulfonivorans)
RXN-9740 [EC: 1.14.13.131]

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBE0 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PS417_16805 5,10-methylene tetrahydromethanopterin reductase (Pseudomonas simiae WCS417)
MSREIRLNAFDMNCVGHQSPGLWAHPRDRSWQYKDLEYWTDLAKILERGKFDGLFIADVL
GIYDVYNGNGDAAIRQAAQVPVNDPLSLIAPMALVTEHLGFGLTASLSFEHPYPFARRLS
TLDHLTKGRVGWNIVTSYLESGAKNLGQQAQTEHDARYDYAEEYLEVCYKLWEGSWEEGA
VLRDRERRIFSDPSKIHEIRHVGKHFQVPGIHLCEPSPQRTPVLYQAGASSRGKQFAAEQ
AECVFVAAPSKVLLKKTVADIRRRAAEAGRDPQKILIFNLQTVIVGETDAKAKAKFDEYK
SYVSYEGAMALISGWTGIDFSQFKPDEPLKHVHTNAIQSAVEAFSTADPNKVWTPNELAD
WVGIGGFGPLFVGGPETVADLLQEWVEETDVDGFNLAYALTHETFIDAVDLLVPELQKRG
VYKTEYAQGTLREKLFGDGARLASNHPGASYRDLKATRL